PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01018947001
Common NameVIT_04s0023g01880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ZF-HD
Protein Properties Length: 411aa    MW: 46456.5 Da    PI: 7.6928
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01018947001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1054.8e-3388144360
        ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                        ++rY+eClkNhAas+Ggh++DGCgEfmps geegt +alkCaAC+CHRnFHR+e + e
  GSVIVT01018947001  88 SIRYRECLKNHAASMGGHVFDGCGEFMPS-GEEGTLEALKCAACDCHRNFHRKEIDGE 144
                        689*************************9.999********************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2388142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.6E-3189141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.1E-3190141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.99891140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466896.16E-18215281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-29218282IPR009057Homeodomain-like
PROSITE profilePS500718.665218282IPR001356Homeobox domain
TIGRFAMsTIGR015652.1E-28220277IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MAEQQAAEIR GRKIMRDIQG VYHRHLHHHQ FNLQQQTQHG EVGDPDPDPD PVSATIAVSG  60
ATATPITGGS NPKVAAAPPH PPPQSAASIR YRECLKNHAA SMGGHVFDGC GEFMPSGEEG  120
TLEALKCAAC DCHRNFHRKE IDGESQPTAN CYYTCNPNTN SSRRNTIAPQ LPPSHAPLPH  180
LHQHHKYSHA PAESSSEDLN MFQSNVGMHL QPQPAFALSK KRFRTKFSQE QKDKMQEFAE  240
KLGWKIQKQE EQEVQQFCSD VGVKRQVFKV WMHNNKQAMK KKQLKTLATS TCIIFLLETY  300
WDLTLSSFHI TSSKSSSPER ERERKEETND KNCTYFPLCL VVMDSWEVSL TYESLFTNLL  360
YYYCTIISCI NPICPFNRQF FGSLKPYHIL LSFSTVEVKQ LDCSCQHTGI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-222192781675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3843460.0FQ384346.1 Vitis vinifera clone SS0AAG1YN20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266577.21e-161PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9ZPW78e-64ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLF6GWV80.0F6GWV8_VITVI; Putative uncharacterized protein
STRINGVIT_04s0023g01880.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-57homeobox protein 24